PDB entry 1co9

View 1co9 on RCSB PDB site
Description: recombinant sperm whale myoglobin l104v mutant (met)
Deposited on 1999-06-07, released 1999-06-14
The last revision prior to the SCOP 1.69 freeze date was dated 1999-06-14, with a file datestamp of 1999-06-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.143
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1co9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1co9A (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikyvefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg