PDB entry 1co7

View 1co7 on RCSB PDB site
Description: R117H mutant rat anionic trypsin complexed with bovine pancreatic trypsin inhibitor (BPTI)
Class: hydrolase/hydrolase inhibitor
Keywords: complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex
Deposited on 1999-06-07, released 2003-01-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: trypsin II
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (Start-244)
      • variant (120)
    Domains in SCOPe 2.05: d1co7e_
  • Chain 'I':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1co7i_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1co7E (E:)
    rallflalvgaavafpvddddkivggytcqensvpyqvslnsgyhfcggslindqwvvsa
    ahcyksriqvrlgehninvlegneqfvnaakiikhpnfdrktlnndimliklsspvklna
    hvatvalpsscapagtqclisgwgntlssgvnepdllqcldapllpqadceasypgkitd
    nmvcvgfleggkdscqgdsggpvvcngelqgivswgygcalpdnpgvytkvcnyvdwiqd
    tiaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1co7E (E:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnahvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1co7I (I:)
    kmsrlclsvallvllgtlaastpgcdtsnqakaqrpdfcleppytgpckariiryfynak
    aglcqtfvyggcrakrnnfksaedcmrtcggaigpwenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1co7I (I:)
    pytgpckariiryfynlcqtfvyggcrakrnnfksaedcmr