PDB entry 1co6

View 1co6 on RCSB PDB site
Description: crystal structure of ferrocytochrome c2 from rhodopseudomonas viridis
Class: electron transport
Keywords: electron transport(heme protein), electron transport
Deposited on 1999-06-05, released 1999-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cytochrome c2)
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1co6a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1co6A (A:)
    qdaasgeqvfkqclvchsigpgaknkvgpvlnglfgrhsgtiegfaysdanknsgitwte
    evfreyirdpkakipgtkmifagvkdeqkvsdliayikqfnadgskk