PDB entry 1co4

View 1co4 on RCSB PDB site
Description: solution structure of a zinc domain conserved in yeast copper-regulated transcription factors
Class: translation/regulation protein
Keywords: metallothionein, amt, metal regulation, translation/regulation protein complex
Deposited on 1999-06-04, released 1999-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (activator of metallothionein 1)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1co4a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1co4A (A:)
    mvvingvkyacdscikshkaaqcehndrplkilkprgrpptt