PDB entry 1co1

View 1co1 on RCSB PDB site
Description: fold of the cbfa
Class: gene regulation
Keywords: cbfa runt aml-1 runt domain, gene regulation
Deposited on 1999-05-31, released 2000-06-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: core binding factor alpha
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01196 (0-114)
  Domains in SCOPe 2.05: d1co1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1co1A (A:)
  elvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrna
  taamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpre