PDB entry 1co1

View 1co1 on RCSB PDB site
Description: fold of the cbfa
Deposited on 1999-05-31, released 2000-06-07
The last revision prior to the SCOP 1.65 freeze date was dated 2000-06-07, with a file datestamp of 2000-06-07.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1co1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1co1A (A:)
elvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrna
taamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpre