PDB entry 1co1

View 1co1 on RCSB PDB site
Description: fold of the cbfa
Class: gene regulation
Keywords: cbfa runt aml-1 runt domain, gene regulation
Deposited on 1999-05-31, released 2000-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: core binding factor alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1co1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1co1A (A:)
    elvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrna
    taamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpre