PDB entry 1cnu

View 1cnu on RCSB PDB site
Description: phosphorylated actophorin from acantamoeba polyphaga
Deposited on 1999-05-24, released 1999-06-01
The last revision prior to the SCOP 1.57 freeze date was dated 1999-06-01, with a file datestamp of 1999-05-31.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1cnua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cnuA (A:)
    giavsddcvqkfnelklghqhryvtfkmnasntevvvehvggpnatyedfksqlperdcr
    yaifdyefqvdggqrnkitfilwapdsapikskmmytstkdsikkklvgiqvevqatdaa
    eisedavserakkd