PDB entry 1cnu

View 1cnu on RCSB PDB site
Description: phosphorylated actophorin from acantamoeba polyphaga
Class: contractile
Keywords: actin-binding protein, adf, cofilin, contractile
Deposited on 1999-05-24, released 1999-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actophorin
    Species: Acanthamoeba polyphaga [TaxId:5757]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cnua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cnuA (A:)
    sgiavsddcvqkfnelklghqhryvtfkmnasntevvvehvggpnatyedfksqlperdc
    ryaifdyefqvdggqrnkitfilwapdsapikskmmytstkdsikkklvgiqvevqatda
    aeisedavserakkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnuA (A:)
    giavsddcvqkfnelklghqhryvtfkmnasntevvvehvggpnatyedfksqlperdcr
    yaifdyefqvdggqrnkitfilwapdsapikskmmytstkdsikkklvgiqvevqatdaa
    eisedavserakkd