PDB entry 1cnt

View 1cnt on RCSB PDB site
Description: ciliary neurotrophic factor
Deposited on 1996-06-06, released 1997-03-26
The last revision prior to the SCOP 1.55 freeze date was dated 1997-03-26, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.55: d1cnt1_
  • Chain '2':
    Domains in SCOP 1.55: d1cnt2_
  • Chain '3':
    Domains in SCOP 1.55: d1cnt3_
  • Chain '4':
    Domains in SCOP 1.55: d1cnt4_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1cnt1 (1:)
    phrrdlcsrsiwlarkirsdltaltesyvkhqglnkninldsadgmpvastdqwseltea
    erlqenlqayrtfhvllarlledqqvhftptegdfhqaihtlllqvaafayqieelmill
    eykiprneadgmpinvgdgglfekklwglkvlqelsqwtvrsihdlrfisshqtgip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnt1 (1:)
    phrrdlcsrsiwlarkirsdltaltesyvkhqglwselteaerlqenlqayrtfhvllar
    lledqqvhftptegdfhqaihtlllqvaafayqieelmilleykiprneadgmlfekklw
    glkvlqelsqwtvrsihdlrfisshqtgip
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1cnt2 (2:)
    hrrdlcsrsiwlarkirsdltaltesyvkhqglnkninldsadgmpvastdqwselteae
    rlqenlqayrtfhvllarlledqqvhftptegdfhqaihtlllqvaafayqieelmille
    ykiprneadgmpinvgdgglfekklwglkvlqelsqwtvrsihdlrfisshqtgip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnt2 (2:)
    hrrdlcsrsiwlarkirsdltaltesyvkhqgllteaerlqenlqayrtfhvllarlleg
    dfhqaihtlllqvaafayqieelmilleykiprnfekklwglkvlqelsqwtvrsihdlr
    fisshqtgip
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1cnt3 (3:)
    phrrdlcsrsiwlarkirsdltaltesyvkhqglnkninldsadgmpvastdqwseltea
    erlqenlqayrtfhvllarlledqqvhftptegdfhqaihtlllqvaafayqieelmill
    eykiprneadgmpinvgdgglfekklwglkvlqelsqwtvrsihdlrfissh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnt3 (3:)
    phrrdlcsrsiwlarkirsdltaltesyvkhqglwselteaerlqenlqayrtfhvllar
    lledqqvhftptegdfhqaihtlllqvaafayqieelmilleykiprneadggglfekkl
    wglkvlqelsqwtvrsihdlrfissh
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1cnt4 (4:)
    hrrdlcsrsiwlarkirsdltaltesyvkhqglnkninldsadgmpvastdqwselteae
    rlqenlqayrtfhvllarlledqqvhftptegdfhqaihtlllqvaafayqieelmille
    ykiprneadgmpinvgdgglfekklwglkvlqelsqwtvrsihdlrfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnt4 (4:)
    hrrdlcsrsiwlarkirsdltaltesyvkhqglelteaerlqenlqayrtfhvllarlle
    dqqegdfhqaihtlllqvaafayqieelmilleykiprnkklwglkvlqelsqwtvrsih
    dlrfis