PDB entry 1cns

View 1cns on RCSB PDB site
Description: crystal structure of chitinase at 1.91a resolution
Class: anti-fungal protein
Keywords: alpha-helical structure, anti-fungal protein
Deposited on 1995-06-24, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.186
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23951 (0-242)
      • conflict (41)
      • conflict (51)
      • conflict (149)
      • conflict (154)
      • conflict (172)
    Domains in SCOPe 2.07: d1cnsa_
  • Chain 'B':
    Compound: chitinase
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23951 (0-242)
      • conflict (41)
      • conflict (51)
      • conflict (149)
      • conflict (154)
      • conflict (172)
    Domains in SCOPe 2.07: d1cnsb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cnsA (A:)
    svssivsraqfdrmllhrndgacqakgfytydafvaaaaafsgfgttgsadvqkrevaaf
    laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
    hnynygpagraigvdllanpdlvatdatvsfktamwfwmtaqppkpsshavivgqwspsg
    adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
    pfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cnsB (B:)
    svssivsraqfdrmllhrndgacqakgfytydafvaaaaafsgfgttgsadvqkrevaaf
    laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
    hnynygpagraigvdllanpdlvatdatvsfktamwfwmtaqppkpsshavivgqwspsg
    adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
    pfa