PDB entry 1cnq

View 1cnq on RCSB PDB site
Description: fructose-1,6-bisphosphatase complexed with fructose-6-phosphate and zinc ions
Class: hydrolase
Keywords: bisphosphatase, hydrolase
Deposited on 1999-05-21, released 1999-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.168
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-1,6-bisphosphatase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cnqa_
  • Heterogens: F6P, ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cnqA (A:)
    tdqaafdtnivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygia
    gstnvtgdqvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpl
    dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
    vncfmldpaigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
    garyvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
    avldivptdihqrapiilgspedvtelleiyqkhaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnqA (A:)
    fdtnivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnv
    tgdqvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssn
    idclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfm
    ldpaigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryv
    gsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldi
    vptdihqrapiilgspedvtelleiyqkhaak