PDB entry 1cno

View 1cno on RCSB PDB site
Description: structure of pseudomonas nautica cytochrome c552, by mad method
Class: electron transport
Keywords: electron transport, pseudomonas nautica, x ray structure, multiwavelength anomalous dispersion, heme, cytochrome c
Deposited on 1998-08-03, released 1999-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c552
    Species: Marinobacter hydrocarbonoclasticus [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82903 (0-83)
      • conflict (35)
      • conflict (81)
    Domains in SCOPe 2.07: d1cnoa_
  • Chain 'B':
    Compound: cytochrome c552
    Species: Marinobacter hydrocarbonoclasticus [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82903 (0-83)
      • conflict (35)
      • conflict (81)
    Domains in SCOPe 2.07: d1cnob_
  • Chain 'C':
    Compound: cytochrome c552
    Species: Marinobacter hydrocarbonoclasticus [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82903 (0-83)
      • conflict (35)
      • conflict (81)
    Domains in SCOPe 2.07: d1cnoc_
  • Chain 'D':
    Compound: cytochrome c552
    Species: Marinobacter hydrocarbonoclasticus [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82903 (0-83)
      • conflict (35)
      • conflict (81)
    Domains in SCOPe 2.07: d1cnod_
  • Chain 'E':
    Compound: cytochrome c552
    Species: Marinobacter hydrocarbonoclasticus [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82903 (0-83)
      • conflict (35)
      • conflict (81)
    Domains in SCOPe 2.07: d1cnoe_
  • Chain 'F':
    Compound: cytochrome c552
    Species: Marinobacter hydrocarbonoclasticus [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82903 (0-83)
      • conflict (35)
      • conflict (81)
    Domains in SCOPe 2.07: d1cnof_
  • Chain 'G':
    Compound: cytochrome c552
    Species: Marinobacter hydrocarbonoclasticus [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82903 (0-83)
      • conflict (35)
      • conflict (81)
    Domains in SCOPe 2.07: d1cnog_
  • Chain 'H':
    Compound: cytochrome c552
    Species: Marinobacter hydrocarbonoclasticus [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82903 (0-83)
      • conflict (35)
      • conflict (81)
    Domains in SCOPe 2.07: d1cnoh_
  • Heterogens: HEC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cnoA (A:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnoA (A:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cnoB (B:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnoB (B:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cnoC (C:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnoC (C:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cnoD (D:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnoD (D:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1cnoE (E:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnoE (E:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1cnoF (F:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnoF (F:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaa
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cnoG (G:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaaa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1cnoH (H:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnoH (H:)
    agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
    qgqatalsdadianlaayyasnpaaa