PDB entry 1cne

View 1cne on RCSB PDB site
Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain
Deposited on 1995-02-01, released 1995-04-20
The last revision prior to the SCOP 1.55 freeze date was dated 1995-04-20, with a file datestamp of 1995-04-27.
Experiment type: -
Resolution: 3 Å
R-factor: 0.19
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cne_ (-)
grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv
deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgrgsfvin
gkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillrdeldrw
aaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalasgpppmiqf
aispnlekmkydmansfvvf