PDB entry 1cnd

View 1cnd on RCSB PDB site
Description: crystal structure of the fad containing fragment of corn nitrate reductase: relationship to other flavoprotein reductases
Deposited on 1994-07-25, released 1994-11-01
The last revision was dated 1995-04-20, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1cnd_ (-)
    vrapalsnprgrihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklc
    mraytptsmvdeighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghve
    ytgrgsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrtedd
    illrdeldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlal
    acgpppmiqfaispnlekmkydmansfvvf
    

    Sequence, based on observed residues (ATOM records):
    >1cnd_ (-)
    grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv
    deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgrgsfvin
    gkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillrdeldrw
    aaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalacgpppmiqf
    aispnlekmkydmansfvvf
    

  • Chain 'p':
    No sequence available.