PDB entry 1cn9

View 1cn9 on RCSB PDB site
Description:
Deposited on 1999-05-26, released 1999-11-19
The last revision prior to the SCOP 1.65 freeze date was dated 1999-11-19, with a file datestamp of 1999-11-18.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cn9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cn9A (A:)
    apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
    lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla