PDB entry 1cn7

View 1cn7 on RCSB PDB site
Description: Yeast ribosomal protein L30
Class: ribosome
Keywords: nmr, ribosomal protein, auto-regulation of pre-mRNA splicing and mRNA translation, ribosome
Deposited on 1999-05-26, released 1999-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60s ribosomal protein l30e
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RPL30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cn7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cn7A (A:)
    apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
    lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla