PDB entry 1cn4

View 1cn4 on RCSB PDB site
Description: erythropoietin complexed with extracellular domains of erythropoietin receptor
Class: haematopoietic cytokine
Keywords: haematopoietic cytokine, cytokine receptor
Deposited on 1999-05-25, released 1999-08-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.28
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (erythropoietin receptor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered (54)
      • engineered (166)
      • engineered (213)
    Domains in SCOPe 2.06: d1cn4a1, d1cn4a2
  • Chain 'B':
    Compound: protein (erythropoietin receptor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235 (Start-227)
      • engineered (54)
      • engineered (166)
      • engineered (213)
    Domains in SCOPe 2.06: d1cn4b1, d1cn4b2
  • Chain 'C':
    Compound: protein (erythropoietin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01588
      • engineered (23)
      • engineered (37)
      • engineered (82)
    Domains in SCOPe 2.06: d1cn4c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cn4A (A:)
    refapppnlpdpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsy
    qledepwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihine
    vvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveileg
    rtecvlsnlrgrtrytfavrarmaepsfggfwsewsepvslltpsdld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cn4A (A:)
    pdpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwkl
    crlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvg
    lvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecvlsnl
    rgrtrytfavrarmaepsfggfwsewsepvslltpsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cn4B (B:)
    refapppnlpdpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsy
    qledepwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihine
    vvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveileg
    rtecvlsnlrgrtrytfavrarmaepsfggfwsewsepvslltpsdld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cn4B (B:)
    dpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklc
    rlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvgl
    varladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecvlsnlr
    grtrytfavrarmaepsfggfwsewsepvslltpsdld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cn4C (C:)
    apprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqa
    vevwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeais
    ppdaasaaplrtitadtfrklfrvysnflrgklklytgeacrtgdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cn4C (C:)
    pprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqav
    evwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeaisp
    pdrtitadtfrklfrvysnflrgklklytgeacr