PDB entry 1cn2

View 1cn2 on RCSB PDB site
Description: solution structure of toxin 2 from centruroides noxius hoffmann, a beta scorpion neurotoxin acting on sodium channels, nmr, 15 structures
Class: neurotoxin
Keywords: neurotoxin, scorpion toxin, centruroides noxius, sodium channels
Deposited on 1998-06-21, released 1999-01-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxin 2
    Species: Centruroides noxius [TaxId:6878]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1cn2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cn2A (A:)
    kegylvdkntgckyeclklgdndyclreckqqygkgaggycyafacwcthlyeqaivwpl
    pnkrcs