PDB entry 1cn1

View 1cn1 on RCSB PDB site
Description: crystal structure of demetallized concanavalin a. the metal-binding region
Class: lectin (agglutinin)
Keywords: lectin (agglutinin)
Deposited on 1981-12-21, released 1982-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin a
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (0-236)
      • insertion (185)
    Domains in SCOPe 2.07: d1cn1a_
  • Chain 'B':
    Compound: concanavalin a
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (0-236)
      • insertion (185)
    Domains in SCOPe 2.07: d1cn1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cn1A (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqdgkvgtahiiynsvdkr
    lsavvsypnadatsvsydvdlndvlpewvrvglsastglyketntilswsftsklksnst
    hqtdalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspegssvgralfyapvh
    iwessaatvsfeatfaflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cn1B (B:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqdgkvgtahiiynsvdkr
    lsavvsypnadatsvsydvdlndvlpewvrvglsastglyketntilswsftsklksnst
    hqtdalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspegssvgralfyapvh
    iwessaatvsfeatfaflikspdshpadgiaffisnidssipsgstgrllglfpdan