PDB entry 1cmz

View 1cmz on RCSB PDB site
Description: solution structure of gaip (galpha interacting protein): a regulator of g protein signaling
Deposited on 1999-05-12, released 1999-11-10
The last revision prior to the SCOP 1.63 freeze date was dated 1999-11-10, with a file datestamp of 1999-11-09.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1cmza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cmzA (A:)
    pspeevqswaqsfdklmhspagrsvfraflrteyseenmlfwlaceelkaeanqhvvdek
    arliyedyvsilspkevsldsrvreginkkmqepsahtfddaqlqiytlmhrdsyprfls
    sptyrall