PDB entry 1cmv

View 1cmv on RCSB PDB site
Description: human cytomegalovirus protease
Class: serine protease
Keywords: coat protein, hydrolase, serine protease, phosphorylation
Deposited on 1996-08-26, released 1997-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.241
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human cytomegalovirus protease
    Species: Human herpesvirus 5 [TaxId:10359]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cmva_
  • Chain 'B':
    Compound: human cytomegalovirus protease
    Species: Human herpesvirus 5 [TaxId:10359]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cmvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cmvA (A:)
    mtmdeqqsqavapvyvggflarydqspdeaelllprdvvehwlhaqgqgqpslsvalpln
    inhddtavvghvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkv
    veflsgsyaglslssrrcddaeaptslsgsettpfkhvalcsvgrrrgtlavygrdpewv
    tqrfpdltaadrdglraqwqrcgstavdasgdpfrsdsygllgnsvdalyirerlpklry
    dkqlvgvteresyvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cmvA (A:)
    apvyvggflarydqspdlprdvvehwalplninhddtavvghvaamqsvrdglfclgcvt
    sprfleivrrasekselvsrgpvsplqpdkvveflsgsyaglslspfkhvalcsvgrrrg
    tlavygrdpewvtqrfpdltaadrdglraqwgdpfrsdsygllgnsvdalyirerlpklr
    ydkqlvgvteresyvka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cmvB (B:)
    mtmdeqqsqavapvyvggflarydqspdeaelllprdvvehwlhaqgqgqpslsvalpln
    inhddtavvghvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkv
    veflsgsyaglslssrrcddaeaptslsgsettpfkhvalcsvgrrrgtlavygrdpewv
    tqrfpdltaadrdglraqwqrcgstavdasgdpfrsdsygllgnsvdalyirerlpklry
    dkqlvgvteresyvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cmvB (B:)
    vapvyvggflarydqspdeaelllprdvvehwlhaalplninhddtavvghvaamqsvrd
    glfclgcvtsprfleivrrasekselvsrgpvsplqpdkvveflsgsyaglslskhvalc
    svgrrrgtlavygrdpewvtqrfpdltaadrdglraqwqrgdpfrsdsygllgnsvdaly
    irerlpklrydkqlvgvteresyvka