PDB entry 1cmo

View 1cmo on RCSB PDB site
Description: immunoglobulin motif dna-recognition and heterodimerization for the pebp2/cbf runt-domain
Deposited on 1999-05-11, released 2000-01-05
The last revision prior to the SCOP 1.69 freeze date was dated 2000-01-18, with a file datestamp of 2000-01-17.
Experiment type: NMR43
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1cmoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cmoA (A:)
  vevladhpgelvrtdspnflcsvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagnde
  nysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvd
  gpreprr