PDB entry 1cmn

View 1cmn on RCSB PDB site
Description: crystal structures of ferric-no complexes of fungal nitric oxide reductase and their ser286 mutants at cryogenic temperature
Class: oxidoreductase
Keywords: nitric oxide reductase, cytochrome p450nor, no-liganded, mutagenesis(s286v), oxidoreductase
Deposited on 1999-05-07, released 2000-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23295 (Start-401)
      • engineered (284)
    Domains in SCOPe 2.07: d1cmna_
  • Heterogens: HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cmnA (A:)
    asgapsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatsekls
    kvrtrqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtv
    ddlleqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngssta
    reasaanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagn
    atmvnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtavalaikrtakedvmig
    dklvranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakae
    lttvfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cmnA (A:)
    apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
    trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
    leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
    saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
    vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtavalaikrtakedvmigdkl
    vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
    vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif