PDB entry 1cmi

View 1cmi on RCSB PDB site
Description: structure of the human pin/lc8 dimer with a bound peptide
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: pin, lc8, nnos, dynein light chain
Deposited on 1999-05-06, released 2000-02-21
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.24
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein inhibitor of neuronal nitric oxide synthase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cmia_
  • Chain 'B':
    Compound: protein inhibitor of neuronal nitric oxide synthase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cmib_
  • Chain 'C':
    Compound: neuronal nitric oxide synthase
  • Chain 'D':
    Compound: neuronal nitric oxide synthase
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cmiA (A:)
    kaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgrnfgs
    yvthetkhfiyfylgqvaillfksg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cmiB (B:)
    kaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgrnfgs
    yvthetkhfiyfylgqvaillfksg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.