PDB entry 1cmg

View 1cmg on RCSB PDB site
Description: nmr solution structure of calcium-loaded calmodulin carboxy-terminal domain
Deposited on 1995-07-19, released 1995-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1cmg__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cmg_ (-)
  mkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgq
  vnyeefvqmmtak