PDB entry 1cmf

View 1cmf on RCSB PDB site
Description: nmr solution structure of apo calmodulin carboxy-terminal domain
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1995-07-19, released 1995-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin (vertebrate)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62157 (0-72)
  Domains in SCOPe 2.05: d1cmfa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cmfA (A:)
  mkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgq
  vnyeefvqmmtak