PDB entry 1cmf

View 1cmf on RCSB PDB site
Description: nmr solution structure of apo calmodulin carboxy-terminal domain
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1995-07-19, released 1995-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 1995-12-07, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin (vertebrate)
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cmfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cmfA (A:)
mkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgq
vnyeefvqmmtak