PDB entry 1cmc

View 1cmc on RCSB PDB site
Description: three dimensional crystal structures of e. coli met repressor with and without corepressor
Deposited on 1992-08-28, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1cmca_
  • Chain 'B':
    Domains in SCOP 1.57: d1cmcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cmcA (A:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cmcB (B:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey