PDB entry 1cmb

View 1cmb on RCSB PDB site
Description: three dimensional crystal structures of escherichia coli met repressor with and without corepressor
Class: DNA-binding regulatory protein
Keywords: DNA-binding regulatory protein
Deposited on 1992-08-28, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: met apo-repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cmba_
  • Chain 'B':
    Compound: met apo-repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cmbb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cmbA (A:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cmbB (B:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey