PDB entry 1cma

View 1cma on RCSB PDB site
Description: met repressor/DNA complex + s-adenosyl-methionine
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription-DNA complex
Deposited on 1992-08-24, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (met repressor)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cmaa_
  • Chain 'B':
    Compound: protein (met repressor)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cmab_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*tp*ap*gp*ap*cp*gp*tp*cp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*gp*ap*cp*gp*tp*cp*tp*a)-3')
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cmaA (A:)
    aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
    flhaftgqplpddadlrkersdeipeaakeimremginpetwey
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cmaB (B:)
    aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
    flhaftgqplpddadlrkersdeipeaakeimremginpetwey
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.