PDB entry 1cma

View 1cma on RCSB PDB site
Description: met repressor/DNA complex + s-adenosyl-methionine
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription-DNA complex
Deposited on 1992-08-24, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (met repressor)
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A8U6 (0-103)
  Domains in SCOPe 2.08: d1cmaa_
• Chain 'B':
  Compound: protein (met repressor)
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A8U6 (0-103)
  Domains in SCOPe 2.08: d1cmab_
• Chain 'C':
  Compound: DNA (5'-d(*tp*tp*ap*gp*ap*cp*gp*tp*cp*t)-3')
  
• Chain 'D':
  Compound: DNA (5'-d(*ap*gp*ap*cp*gp*tp*cp*tp*a)-3')
  
• Heterogens: SAM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cmaA (A:)
  aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
  flhaftgqplpddadlrkersdeipeaakeimremginpetwey
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cmaB (B:)
  aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
  flhaftgqplpddadlrkersdeipeaakeimremginpetwey
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.