PDB entry 1cm8

View 1cm8 on RCSB PDB site
Description: phosphorylated map kinase p38-gamma
Class: transferase
Keywords: p38-gamma, gamma, phosphorylation, map kinase
Deposited on 1999-05-17, released 2000-05-17
The last revision prior to the SCOP 1.73 freeze date was dated 2000-05-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphorylated map kinase p38-gamma
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53778
      • modified residue (182)
      • modified residue (184)
    Domains in SCOP 1.73: d1cm8a_
  • Chain 'B':
    Compound: phosphorylated map kinase p38-gamma
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53778
      • modified residue (182)
      • modified residue (184)
    Domains in SCOP 1.73: d1cm8b_
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cm8A (A:)
    mssppparsgfyrqevtktawevravyrdlqpvgsgaygavcsavdgrtgakvaikklyr
    pfqselfakrayrelrllkhmrhenviglldvftpdetlddftdfylvmpfmgtdlgklm
    kheklgedriqflvyqmlkglryihaagiihrdlkpgnlavnedcelkildfglarqads
    emtgyvvtrwyrapevilnwmrytqtvdiwsvgcimaemitgktlfkgsdhldqlkeimk
    vtgtppaefvqrlqsdeaknymkglpelekkdfasiltnasplavnllekmlvldaeqrv
    tagealahpyfeslhdtedepqvqkyddsfddvdrtldewkrvtykevlsfkpprqlgar
    vsketpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cm8A (A:)
    rsgfyrqevtktawevravyrdlqpvavcsavdgrtgakvaikklyrpfqselfakrayr
    elrllkhmrhenviglldvftpdetlddftdfylvmpfmgtdlgklmkheklgedriqfl
    vyqmlkglryihaagiihrdlkpgnlavnedcelkildfglarqadsemtgyvvtrwyra
    pevilnwmrytqtvdiwsvgcimaemitgktlfkgsdhldqlkeimkvtgtppaefvqrl
    qsdeaknymkglpelekkdfasiltnasplavnllekmlvldaeqrvtagealahpyfes
    lhqvqkyddsrtldewkrvtykevlsfkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cm8B (B:)
    mssppparsgfyrqevtktawevravyrdlqpvgsgaygavcsavdgrtgakvaikklyr
    pfqselfakrayrelrllkhmrhenviglldvftpdetlddftdfylvmpfmgtdlgklm
    kheklgedriqflvyqmlkglryihaagiihrdlkpgnlavnedcelkildfglarqads
    emtgyvvtrwyrapevilnwmrytqtvdiwsvgcimaemitgktlfkgsdhldqlkeimk
    vtgtppaefvqrlqsdeaknymkglpelekkdfasiltnasplavnllekmlvldaeqrv
    tagealahpyfeslhdtedepqvqkyddsfddvdrtldewkrvtykevlsfkpprqlgar
    vsketpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cm8B (B:)
    rsgfyrqevtktawevravyrdlqpvavcsavdgrtgakvaikklyrpfqselfakrayr
    elrllkhmrhenviglldvftpdetlddftdfylvmpfmgtdlgklmkheklgedriqfl
    vyqmlkglryihaagiihrdlkpgnlavnedcelkildfglarqadsemtgyvvtrwyra
    pevilnwmrytqtvdiwsvgcimaemitgktlfkgsdhldqlkeimkvtgtppaefvqrl
    qsdeaknymkglpelekkdfasiltnasplavnllekmlvldaeqrvtagealahpyfes
    lhqvqkyddsrtldewkrvtykevlsfkp