PDB entry 1cm7

View 1cm7 on RCSB PDB site
Description: 3-isopropylmalate dehydrogenase from escherichia coli
Deposited on 1999-05-17, released 1999-07-01
The last revision prior to the SCOP 1.55 freeze date was dated 1999-07-01, with a file datestamp of 1999-06-30.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.173
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cm7a_
  • Chain 'B':
    Domains in SCOP 1.55: d1cm7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cm7A (A:)
    msknyhiavlpgdgigpevmtqalkvldavrnrfamrittshydvggaaidnhgqplppa
    tvegceqadavlfgsvggpkwehlppdqqpergallplrkhfklfsnlrpaklyqgleaf
    cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
    esarkrrhkvtsidkanvlqssilwreivneiateypdvelahmyidnatmqlikdpsqf
    dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
    qilslalllrysldaddaacaierainraleegirtgdlargaaavstdemgdiiaryva
    egv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cm7B (B:)
    msknyhiavlpgdgigpevmtqalkvldavrnrfamrittshydvggaaidnhgqplppa
    tvegceqadavlfgsvggpkwehlppdqqpergallplrkhfklfsnlrpaklyqgleaf
    cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
    esarkrrhkvtsidkanvlqssilwreivneiateypdvelahmyidnatmqlikdpsqf
    dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
    qilslalllrysldaddaacaierainraleegirtgdlargaaavstdemgdiiaryva
    egv