PDB entry 1cm7

View 1cm7 on RCSB PDB site
Description: 3-isopropylmalate dehydrogenase from escherichia coli
Class: oxidoreductase
Keywords: oxidoreductase, dehydrogenase, nad-dependant enzyme, leucine biosynthetic pathway
Deposited on 1999-05-17, released 1999-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (3-isopropylmalate dehydrogenase)
    Species: Escherichia coli [TaxId:562]
    Gene: LEUB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cm7a_
  • Chain 'B':
    Compound: protein (3-isopropylmalate dehydrogenase)
    Species: Escherichia coli [TaxId:562]
    Gene: LEUB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cm7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cm7A (A:)
    msknyhiavlpgdgigpevmtqalkvldavrnrfamrittshydvggaaidnhgqplppa
    tvegceqadavlfgsvggpkwehlppdqqpergallplrkhfklfsnlrpaklyqgleaf
    cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
    esarkrrhkvtsidkanvlqssilwreivneiateypdvelahmyidnatmqlikdpsqf
    dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
    qilslalllrysldaddaacaierainraleegirtgdlargaaavstdemgdiiaryva
    egv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cm7B (B:)
    msknyhiavlpgdgigpevmtqalkvldavrnrfamrittshydvggaaidnhgqplppa
    tvegceqadavlfgsvggpkwehlppdqqpergallplrkhfklfsnlrpaklyqgleaf
    cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
    esarkrrhkvtsidkanvlqssilwreivneiateypdvelahmyidnatmqlikdpsqf
    dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
    qilslalllrysldaddaacaierainraleegirtgdlargaaavstdemgdiiaryva
    egv