PDB entry 1cm5

View 1cm5 on RCSB PDB site
Description: crystal structure of c418a,c419a mutant of pfl from e.coli
Class: transferase
Keywords: glycyl radical enzyme, transferase, glucose metabolism
Deposited on 1999-05-14, released 1999-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (pyruvate formate-lyase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09373 (0-758)
      • engineered (417-418)
    Domains in SCOPe 2.07: d1cm5a_
  • Chain 'B':
    Compound: protein (pyruvate formate-lyase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09373 (0-758)
      • engineered (417-418)
    Domains in SCOPe 2.07: d1cm5b_
  • Heterogens: CO3, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cm5A (A:)
    selneklatawegftkgdwqnevnvrdfiqknytpyegdesflagateatttlwdkvmeg
    vklenrthapvdfdtavastitshdagyinkqlekivglqteaplkralipfggikmieg
    sckaynreldpmikkifteyrkthnqgvfdvytpdilrcrksgvltglpdaygrgriigd
    yrrvalygidylmkdklaqftslqadlengvnleqtirlreeiaeqhralgqmkemaaky
    gydisgpatnaqeaiqwtyfgylaavksqngaamsfgrtstfldvyierdlkagkiteqe
    aqemvdhlvmklrmvrflrtpeydelfsgdpiwatesiggmgldgrtlvtknsfrflntl
    ytmgpspepnmtilwseklplnfkkfaakvsidtsslqyenddlmrpdfnnddyaiaaav
    spmivgkqmqffgaranlaktmlyainggvdeklkmqvgpksepikgdvlnydevmermd
    hfmdwlakqyitalniihymhdkysyeaslmalhdrdvirtmacgiaglsvaadslsaik
    yakvkpirdedglaidfeiegeypqfgnndprvddlavdlverfmkkiqklhtyrdaipt
    qsvltitsnvvygkktgntpdgrragapfgpganpmhgrdqkgavasltsvaklpfayak
    dgisytfsivpnalgkddevrktnlaglmdgyfhheasieggqhlnvnvmnremlldame
    npekypqltirvsgyavrfnsltkeqqqdvitrtftqsm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cm5B (B:)
    selneklatawegftkgdwqnevnvrdfiqknytpyegdesflagateatttlwdkvmeg
    vklenrthapvdfdtavastitshdagyinkqlekivglqteaplkralipfggikmieg
    sckaynreldpmikkifteyrkthnqgvfdvytpdilrcrksgvltglpdaygrgriigd
    yrrvalygidylmkdklaqftslqadlengvnleqtirlreeiaeqhralgqmkemaaky
    gydisgpatnaqeaiqwtyfgylaavksqngaamsfgrtstfldvyierdlkagkiteqe
    aqemvdhlvmklrmvrflrtpeydelfsgdpiwatesiggmgldgrtlvtknsfrflntl
    ytmgpspepnmtilwseklplnfkkfaakvsidtsslqyenddlmrpdfnnddyaiaaav
    spmivgkqmqffgaranlaktmlyainggvdeklkmqvgpksepikgdvlnydevmermd
    hfmdwlakqyitalniihymhdkysyeaslmalhdrdvirtmacgiaglsvaadslsaik
    yakvkpirdedglaidfeiegeypqfgnndprvddlavdlverfmkkiqklhtyrdaipt
    qsvltitsnvvygkktgntpdgrragapfgpganpmhgrdqkgavasltsvaklpfayak
    dgisytfsivpnalgkddevrktnlaglmdgyfhheasieggqhlnvnvmnremlldame
    npekypqltirvsgyavrfnsltkeqqqdvitrtftqsm