PDB entry 1cm2

View 1cm2 on RCSB PDB site
Description: structure of his15asp hpr after hydrolysis of ringed species.
Class: transferase
Keywords: phosphotransferase, succinimide, isoimide
Deposited on 1999-05-13, released 2000-05-17
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: histidine-containing protein
  Species: Escherichia coli
  Gene: PTSH
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA04 (0-84)
    • engineered (14)
  Domains in SCOP 1.73: d1cm2a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cm2A (A:)
  mfqqevtitapngldtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
  vtisaegedeqkavehlvklmaele