PDB entry 1cm2

View 1cm2 on RCSB PDB site
Description: structure of his15asp hpr after hydrolysis of ringed species.
Deposited on 1999-05-13, released 2000-05-17
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-17, with a file datestamp of 2000-05-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1cm2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cm2A (A:)
    mfqqevtitapngldtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele