PDB entry 1cm2

View 1cm2 on RCSB PDB site
Description: structure of his15asp hpr after hydrolysis of ringed species.
Class: transferase
Keywords: phosphotransferase, succinimide, isoimide
Deposited on 1999-05-13, released 2000-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine-containing protein
    Species: Escherichia coli [TaxId:562]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA04 (0-84)
      • engineered (14)
    Domains in SCOPe 2.08: d1cm2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cm2A (A:)
    mfqqevtitapngldtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele