PDB entry 1cm0

View 1cm0 on RCSB PDB site
Description: crystal structure of the pcaf/coenzyme-a complex
Deposited on 1999-05-12, released 1999-07-06
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-25, with a file datestamp of 2001-04-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1cm0a_
  • Chain 'B':
    Domains in SCOP 1.59: d1cm0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cm0A (A:)
    kviefhvvgnslnqkpnkkilmwlvglqnvfshqlprmpkeyitrlvfdpkhktlalikd
    grviggicfrmfpsqgfteivfcavtsneqvkgygthlmnhlkeyhikhdilnfltyade
    yaigyfkkqgfskeikipktkyvgyikdyegatlmgcelnpri
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cm0B (B:)
    kviefhvvgnslnqkpnkkilmwlvglqnvfshqlprmpkeyitrlvfdpkhktlalikd
    grviggicfrmfpsqgfteivfcavtsneqvkgygthlmnhlkeyhikhdilnfltyade
    yaigyfkkqgfskeikipktkyvgyikdyegatlmgcelnpr