PDB entry 1cm0

View 1cm0 on RCSB PDB site
Description: crystal structure of the pcaf/coenzyme-a complex
Class: signaling protein
Keywords: p300/cbp associated factor, coenzyme a, acetyltransferase, coactivator, signaling protein
Deposited on 1999-05-12, released 1999-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p300/cbp associating factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cm0a_
  • Chain 'B':
    Compound: p300/cbp associating factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cm0b_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cm0A (A:)
    mkviefhvvgnslnqkpnkkilmwlvglqnvfshqlprmpkeyitrlvfdpkhktlalik
    dgrviggicfrmfpsqgfteivfcavtsneqvkgygthlmnhlkeyhikhdilnfltyad
    eyaigyfkkqgfskeikipktkyvgyikdyegatlmgcelnpripyte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cm0A (A:)
    kviefhvvgnslnqkpnkkilmwlvglqnvfshqlprmpkeyitrlvfdpkhktlalikd
    grviggicfrmfpsqgfteivfcavtsneqvkgygthlmnhlkeyhikhdilnfltyade
    yaigyfkkqgfskeikipktkyvgyikdyegatlmgcelnpri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cm0B (B:)
    mkviefhvvgnslnqkpnkkilmwlvglqnvfshqlprmpkeyitrlvfdpkhktlalik
    dgrviggicfrmfpsqgfteivfcavtsneqvkgygthlmnhlkeyhikhdilnfltyad
    eyaigyfkkqgfskeikipktkyvgyikdyegatlmgcelnpripyte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cm0B (B:)
    kviefhvvgnslnqkpnkkilmwlvglqnvfshqlprmpkeyitrlvfdpkhktlalikd
    grviggicfrmfpsqgfteivfcavtsneqvkgygthlmnhlkeyhikhdilnfltyade
    yaigyfkkqgfskeikipktkyvgyikdyegatlmgcelnpr