PDB entry 1clz

View 1clz on RCSB PDB site
Description: igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester
Class: immunoglobulin
Keywords: immunoglobulin c region, glycoprotein, transmembrane, immunoglobulin
Deposited on 1995-03-15, released 1996-08-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg fab (igg3, kappa)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1clzh1, d1clzh2
  • Chain 'L':
    Compound: igg fab (igg3, kappa)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-218)
      • conflict (6)
      • conflict (8)
      • conflict (26)
      • conflict (26)
      • conflict (49)
      • conflict (100)
      • conflict (104)
    Domains in SCOPe 2.05: d1clzl1, d1clzl2
  • Heterogens: NON

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clzH (H:)
    evnlvesggglvqpggslkvscvtsgftfsdyymywvrqtpekrlewvayisqggditdy
    pdtvkgrftisrdnaknslylqmsrlksedtamyycarglddgawfaywgqgtlvtvsvt
    ttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfy
    slsslvtvpsstwpsqtvicnvahpasktelikriepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clzL (L:)
    dvlmtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec