PDB entry 1clz

View 1clz on RCSB PDB site
Description: igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester
Deposited on 1995-03-15, released 1996-08-01
The last revision prior to the SCOP 1.69 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clzH (H:)
    evnlvesggglvqpggslkvscvtsgftfsdyymywvrqtpekrlewvayisqggditdy
    pdtvkgrftisrdnaknslylqmsrlksedtamyycarglddgawfaywgqgtlvtvsvt
    ttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfy
    slsslvtvpsstwpsqtvicnvahpasktelikriepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clzL (L:)
    dvlmtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec