PDB entry 1clx

View 1clx on RCSB PDB site
Description: catalytic core of xylanase a
Deposited on 1995-08-31, released 1996-06-20
The last revision prior to the SCOP 1.57 freeze date was dated 1996-06-20, with a file datestamp of 1996-06-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1clxa_
  • Chain 'B':
    Domains in SCOP 1.57: d1clxb_
  • Chain 'C':
    Domains in SCOP 1.57: d1clxc_
  • Chain 'D':
    Domains in SCOP 1.57: d1clxd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clxA (A:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clxB (B:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clxC (C:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clxD (D:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals