PDB entry 1clx

View 1clx on RCSB PDB site
Description: catalytic core of xylanase a
Class: xylanase
Keywords: xylanase, family-f xylanase family 10 glycosyl-hydrolase
Deposited on 1995-08-31, released 1996-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase a
    Species: Cellvibrio japonicus [TaxId:155077]
    Gene: TRUNCATED XYNA (CODONS 264-611
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1clxa_
  • Chain 'B':
    Compound: xylanase a
    Species: Cellvibrio japonicus [TaxId:155077]
    Gene: TRUNCATED XYNA (CODONS 264-611
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1clxb_
  • Chain 'C':
    Compound: xylanase a
    Species: Cellvibrio japonicus [TaxId:155077]
    Gene: TRUNCATED XYNA (CODONS 264-611
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1clxc_
  • Chain 'D':
    Compound: xylanase a
    Species: Cellvibrio japonicus [TaxId:155077]
    Gene: TRUNCATED XYNA (CODONS 264-611
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1clxd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1clxA (A:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1clxA (A:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1clxB (B:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1clxB (B:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1clxC (C:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1clxC (C:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1clxD (D:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1clxD (D:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals