PDB entry 1clv

View 1clv on RCSB PDB site
Description: yellow meal worm alpha-amylase in complex with the amaranth alpha-amylase inhibitor
Class: hydrolase
Keywords: insect alpha-amylase inhibitor, amaranthus hypochondriacus, yellow meal worm, x-ray structure, knottin, hydrolase
Deposited on 1999-05-04, released 2000-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha-amylase)
    Species: Tenebrio molitor [TaxId:7067]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56634 (0-470)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1clva1, d1clva2
  • Chain 'I':
    Compound: protein (alpha-amylase inhibitor)
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1clvi_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clvA (A:)
    ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery
    qpvsyiintrsgdesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny
    pavpygsgdfhspcevnnyqdadnvrncelvglrdlnqgsdyvrgvlidymnhmidlgva
    gfrvdaakhmspgdlsvifsglknlntdygfadgarpfiyqevidlggeaiskneytgfg
    cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk
    npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc
    ehrwrqvygmvgfrnavegtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglp
    agtycdvisgelsggsctgksvtvgdngsadislgsaeddgvlaihvnakl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clvI (I:)
    cipkwnrcgpkmdgvpccepytctsdyygncs