PDB entry 1clq

View 1clq on RCSB PDB site
Description: crystal structure of a replication fork dna polymerase editing complex at 2.7 a resolution
Deposited on 1999-04-30, released 1999-10-28
The last revision prior to the SCOP 1.67 freeze date was dated 1999-10-28, with a file datestamp of 1999-10-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clqA (A:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfdipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniidvyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslne
    mlfraqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierk
    vneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarerme
    paidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtry
    aepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisia
    svssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnp
    fgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm
    fdf