PDB entry 1clq

View 1clq on RCSB PDB site
Description: crystal structure of a replication fork DNA polymerase editing complex at 2.7 a resolution
Class: transferase/DNA
Keywords: DNA polymerase, gp43, proofreading, editing, replication, transferase/DNA complex
Deposited on 1999-04-30, released 1999-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (DNA polymerase)
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: GENE 43
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1clqa1, d1clqa2
  • Chain 'D':
    Compound: DNA (5'-d(*ap*gp*tp*ap*gp*tp*tp*cp*cp*gp*cp*g)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*gp*gp*ap*ap*cp*tp*ap*cp*t)-3')
    Species: synthetic, synthetic
  • Heterogens: CA, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clqA (A:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfdipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniidvyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslne
    mlfraqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierk
    vneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarerme
    paidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtry
    aepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisia
    svssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnp
    fgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm
    fdf
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.