PDB entry 1clp

View 1clp on RCSB PDB site
Description: crystal structure of a calcium-independent phospholipaselike myotoxic protein from bothrops asper venom
Class: hydrolase
Keywords: hydrolase
Deposited on 1994-09-12, released 1994-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.165
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myotoxin II
    Species: Bothrops asper [TaxId:8722]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1clpa_
  • Chain 'B':
    Compound: myotoxin II
    Species: Bothrops asper [TaxId:8722]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1clpb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1clpA (A:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenlntynkkyryylkplckkada
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1clpB (B:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenlntynkkyryylkplckkada
c