PDB entry 1clo

View 1clo on RCSB PDB site
Description: anti-carcinoembryonic antigen monoclonal antibody a5b7
Class: immunoglobulin
Keywords: immunoglobulin, fab-fragment
Deposited on 1996-05-01, released 1997-05-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: a5b7 monoclonal antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1cloh1, d1cloh2
  • Chain 'L':
    Compound: a5b7 monoclonal antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB34980 (0-212)
      • conflict (1)
      • conflict (4)
      • conflict (10)
      • conflict (17)
      • conflict (23)
      • conflict (25)
      • conflict (29)
      • conflict (31)
      • conflict (38)
      • conflict (40)
      • conflict (44)
      • conflict (48)
      • conflict (51)
      • conflict (75-76)
      • conflict (88)
      • conflict (92)
      • conflict (94)
      • conflict (111)
    Domains in SCOPe 2.03: d1clol1, d1clol2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cloH (H:)
    evklvesggglvqpggslrlscatsgftftdyymnwvrqppgkalewlgfignkangytt
    eysasvkgrftisrdksqsilylqmntlraedsatyyctrdrglrfyfdywgqgttltvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cloL (L:)
    qtvlsqspailsaspgekvtmtcrasssvtyihwyqqkpgsspkswiyatsnlasgvpar
    fsgsgsgtsysltisrveaedaatyycqhwsskpptfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec