PDB entry 1cln

View 1cln on RCSB PDB site
Description: three-dimensional structure of calmodulin
Deposited on 1987-01-01, released 1987-04-16
The last revision was dated 1988-07-16, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: CA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1cln_ (-)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee
    vdemireanidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records):
    >1cln_ (-)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    emireanidgdgqvnyeefvqmmta
    

  • Chain 'p':
    No sequence available.